Protein Info for PP_1059 in Pseudomonas putida KT2440

Annotation: Uncharacterized amino acid permease YtnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 345 to 362 (18 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 410 to 432 (23 residues), see Phobius details amino acids 438 to 457 (20 residues), see Phobius details PF00324: AA_permease" amino acids 26 to 452 (427 residues), 419.3 bits, see alignment E=2e-129 PF13520: AA_permease_2" amino acids 29 to 429 (401 residues), 143.5 bits, see alignment E=9.9e-46

Best Hits

Swiss-Prot: 68% identical to YTNA_BACSU: Uncharacterized amino acid permease YtnA (ytnA) from Bacillus subtilis (strain 168)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 100% identity to ppu:PP_1059)

MetaCyc: 46% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88NZ4 at UniProt or InterPro

Protein Sequence (472 amino acids)

>PP_1059 Uncharacterized amino acid permease YtnA (Pseudomonas putida KT2440)
MPVGNHSAHGQATEGGPLKRELGERHIRLMALGACIGVGLFLGSAKAIEMAGPAIMLSYI
IGGLAILVIMRALGEMAVHNPVAGSFSRYAQDYLGPLAGFLTGWNYWFLWLVTCVAEITA
VAIYMGIWFPDVPRWIWALAALGSMGAVNLVAVKAFGEFEFWFALIKIVTIIAMVLGGIG
IIAFGFGNDGVAVGISNLWSNGGFMPNGVTGVLMSLQMVMFAYLGVEMIGLTAGEARNPQ
KTIPQAIGSVFWRILLFYVGALFVILSIYPWNEIGSQGSPFVMTFERLGIKTAAGIINFV
VITAALSSCNGGIFSTGRMLYSLAQNGQAPAAFARTSKNGVPRNALLLSIGALLLGVLAN
YLVPEKVFVWVTSIATFGAIWTWVMILLAQLKFRAGLTTAERKALKYRMWLWPLSSYLAL
AFLVLVVGLMAYFEDTRVALYIGPAFLVLLTVLYYTFRLAPKDAQGVTSTAS