Protein Info for PP_1053 in Pseudomonas putida KT2440

Annotation: Type II secretion pathway protein XcpY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 229 to 247 (19 residues), see Phobius details TIGR01709: type II secretion system protein L" amino acids 19 to 353 (335 residues), 249 bits, see alignment E=4.2e-78 PF12693: GspL_C" amino acids 220 to 353 (134 residues), 111.6 bits, see alignment E=1.7e-36

Best Hits

KEGG orthology group: K02461, general secretion pathway protein L (inferred from 100% identity to ppu:PP_1053)

Predicted SEED Role

"General secretion pathway protein L (Pullulanase secretion protein pulL)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P00 at UniProt or InterPro

Protein Sequence (362 amino acids)

>PP_1053 Type II secretion pathway protein XcpY (Pseudomonas putida KT2440)
MGALMKLEWRRRTPAQAWLLLRPGAVWHWALVQDGILQSEGQGEPPANPQAHVALVLPAE
ACSHFRVPAPPGLKREEWPLLLEDRLLQAPHEVACACLAREPGYLRLLVVARQQLDDWRG
QCPEWGLQTVRCWAELQLLPSPEPGCAWQWQRTPGMSLYKGLAEDGQEHWLAWPDALGGV
PQPPWAVLHRTSLSGNWPTVFAPLDTLPGLFDRARKVRSLPAASRQQQRLLAACLVLATV
WGGLWLSQQWRQAQLWRSQVIAVTGEQASPRHAAQALKRLRESVLQQQLRTRQLDDLQAR
LQTWLRDNPGLRLQAVRFDGQRWHLRLEGEGSAPPWPDMAAAAGATVQVQDGQVIFDLGA
AS