Protein Info for PP_1047 in Pseudomonas putida KT2440

Annotation: putative protein secretion protein for export

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF22341: GSPE_N1E" amino acids 3 to 64 (62 residues), 34 bits, see alignment E=2.7e-12 PF00437: T2SSE" amino acids 100 to 479 (380 residues), 451.2 bits, see alignment E=2.2e-139

Best Hits

Swiss-Prot: 53% identical to GSPE_AERHY: Type II secretion system protein E (exeE) from Aeromonas hydrophila

KEGG orthology group: K02454, general secretion pathway protein E (inferred from 100% identity to ppu:PP_1047)

Predicted SEED Role

"General secretion pathway protein E / Type II secretion cytoplasmic ATP binding protein (PulE, ATPase)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P06 at UniProt or InterPro

Protein Sequence (483 amino acids)

>PP_1047 putative protein secretion protein for export (Pseudomonas putida KT2440)
MMLPYRQARQSGVAMAPAEQGWQLWLRPDADNAQLQELLRVHGQPSLLEYLEPALFDERL
GQLYQAGDAATEALIEGIGDQVDLDSLMSEMPRIEDLLESDDEAPVIRLINGLFGQALRL
RASDIHIETFEQSLVVRLRVDGHLREVLRPPRALSAMLVSRIKVMARLDIAEKRQPQDGR
ITLRAAGREVDVRVSTLPGIHGERVVMRVLDKQASLLALDNLGMPAAVLQGLRSCLARPN
GIVLSTGPTGSGKTTTLYASLNSLNDGSRNILTVEDPVEYAIAGIGQTAINPRAGLTFAS
GLRAILRQDPDVIMLGEIRDQETAQIAVQASLTGHLVLSTLHTNNAVGAVTRLRDMGIEP
FLIASCLRGVLAQRLVRRLCSCAVAHPLQAAERELWPELAALGCSYHAVGCEQCQGSGYI
GRLGLYEFIELDAGLIGLLYDGASELAMQDYLADRRQSLVAMASDCLARGETSLAEVLRV
VQG