Protein Info for PP_1046 in Pseudomonas putida KT2440

Annotation: Type II secretion pathway protein XcpQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 35 to 105 (71 residues), 83.7 bits, see alignment E=9.9e-28 PF03958: Secretin_N" amino acids 133 to 194 (62 residues), 47.3 bits, see alignment E=3e-16 amino acids 201 to 287 (87 residues), 56.6 bits, see alignment E=3.6e-19 TIGR02517: type II secretion system protein D" amino acids 252 to 542 (291 residues), 374.2 bits, see alignment E=5.8e-116 PF00263: Secretin" amino acids 374 to 535 (162 residues), 168 bits, see alignment E=2.2e-53

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to ppu:PP_1046)

Predicted SEED Role

"General secretion pathway protein D / Type II secretion outermembrane pore forming protein (PulD)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P07 at UniProt or InterPro

Protein Sequence (584 amino acids)

>PP_1046 Type II secretion pathway protein XcpQ (Pseudomonas putida KT2440)
MPVRYCMAAALSLALSMAYAQEPVFDDNGTPMYEVNFVDTELGEFIDSVSRITGTTFIVD
PRVKGKVTVRTVDLHDADAIYDIFLAQLRAQGYATVDLPNGSVKIVPDQAARLEPVPVEA
GGQQGEGSDSVATRVFSVRNAASEQVLGILKPLIDPRVGVITPYPAAHQLVVTDWRSNLE
RIASLLRQLDRPQEVPGSGSTQVIYLRHANAGEVVKVLRGLSQEGAVPVEGAGEAEGKDR
PVVPAAGGSGIRLEYEEGTNAVVMVGPDSELAAYRAIVEQLDIRRAQVVVEAIIAEVSDS
SAQELGVQWLFADEKFGAGIVNFGSNGVNIASIAGAAASGDNEALGDLLSTTTGATAGIG
HFGGGFNFAMLVNALKGKSGFNLLSTPTLLTLDNAEASILVGQEVPFVTGSVTQNNANPY
QTIERKEVGVKLRIKPQINIDNSVRLDIVQEVSSIADTSSASDVITNKREIKTKVMVEDN
GLVILGGLISDELSTSDQRVPLLGDIPYLGRLFRSDATRNTKQNLMVFIRPRILRDGPSL
AGLSEDKYRTLQQTTPLQLPDLAEGTRLLQVFPASRARLEGGDW