Protein Info for PP_1036 in Pseudomonas putida KT2440

Annotation: membrane-bound lytic murein transglycosylase F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00497: SBP_bac_3" amino acids 43 to 266 (224 residues), 68.1 bits, see alignment E=6.6e-23 PF01464: SLT" amino acids 293 to 401 (109 residues), 80.6 bits, see alignment E=6.6e-27

Best Hits

Swiss-Prot: 100% identical to MLTF_PSEPK: Membrane-bound lytic murein transglycosylase F (mltF) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: None (inferred from 99% identity to ppf:Pput_1077)

Predicted SEED Role

"Transglycosylase, Slt family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P17 at UniProt or InterPro

Protein Sequence (485 amino acids)

>PP_1036 membrane-bound lytic murein transglycosylase F (Pseudomonas putida KT2440)
MFAHTALRQRCAKWLLATGLFLLLGACVEKPSTLERVKEDGVLRVITRNSPATYFQDRNG
ETGFEYELVQHFADDLGVKLQIETADNLDELYDALGKPSGPVLAAAGLVSSERRKTQVRY
SHPYLEVTPQVIYRNGRPRPTGAKGLVGKKIMVLKGSSHADQLAELKKQYPALQYEESDA
VEVVDLLRMVDEGQIDLTLVDSNELAMNQVYFPNVRVAFDLGETRDQRWAVAAGEDNSLL
NEINEYLDKAQKNGTLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPKYEKHFKSYAKVE
QVDWRLLAAIGYQESMWQPEVTSKTGVRGLMMLTQRTAQAMGVSNRLDPRQSIQGGAKYF
MKIKEELDDSIKEPDRTWFALAAYNVGGGHLEDARTLAKREKLNPNKWLDVKKMLPRLAQ
KQWYRQTKYGYARGGEPVHFVANIRRYYDILTWVTQPQLEGQVAEGNLHVPGVNKDKPAD
KSSPM