Protein Info for PP_1033 in Pseudomonas putida KT2440

Annotation: Sulfatase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 transmembrane" amino acids 41 to 64 (24 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 168 to 192 (25 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details PF00884: Sulfatase" amino acids 287 to 565 (279 residues), 112.8 bits, see alignment E=2.1e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_1033)

Predicted SEED Role

"sulfatase domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P20 at UniProt or InterPro

Protein Sequence (662 amino acids)

>PP_1033 Sulfatase domain protein (Pseudomonas putida KT2440)
MGCLSLKTGCAGAGLLPAYRFRQDAGSVNAKVDTMWLRNSLLHISLLLAAGLLLAPKIIL
IEFFSYRWVETGVFDIALYLLQDVLLVVALYVIAANTITRNKFNFYLLSIASGALLLFLL
VDMRVRELWLKPLDWQLISYSLQNASNLTSGAEVFLTQAAGFGHTFRFIVFVLFLAYLAT
WSFAGLATYIAYKEQRTRTVKKRQHLWASLLVIGALLFGSIHAKSARYHLNENIVISPLV
TTLRNTTSLTLTAAPHRPSLPFEQPAYPLTSVNEIQKLQSHPTPDFKNLVFIVLESVRWN
SVFAPDIKTAERYPTFDKLAREGMLFKSYVSVPHSSKGYHAILTGLHAYPDIEIKEAMYL
LQPSVIHELKNRKNMEAVAFSSLYLQFENMEGFLKSIGVSNAYGISELIPAENRSQNASS
FGESDEQLFSSSIAYLENIKKNGKGFIALYFPSAAHYPYQCSQGPPLQSELEKYEDCIAK
TDSVLGEMLTSFDKQGLLDSTLFVLVGDHGESFGEHGLFIHNASMHEEEVSVPLIFWSNG
KSLPKPASTTSHQIDVAPTVADFFDVTESSLSVQGISLLREQGKRTFFMSTFFDQLASAL
VEHPYKYIYEFSSDTLTKYNLEDDPQEKHPQRVEGDEFIAVRSRLLSYNAYQKALFARKP
EE