Protein Info for PP_1031 in Pseudomonas putida KT2440

Annotation: IMP dehydrogenase and single strand DNA binding factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 PF00478: IMPDH" amino acids 8 to 475 (468 residues), 556.7 bits, see alignment E=2.8e-171 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 8 to 456 (449 residues), 634.7 bits, see alignment E=4.4e-195 PF00571: CBS" amino acids 94 to 139 (46 residues), 38.6 bits, see alignment 1.7e-13 amino acids 148 to 203 (56 residues), 26.9 bits, see alignment 7.4e-10

Best Hits

Swiss-Prot: 73% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 100% identity to ppu:PP_1031)

MetaCyc: 68% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P22 at UniProt or InterPro

Protein Sequence (489 amino acids)

>PP_1031 IMP dehydrogenase and single strand DNA binding factor (Pseudomonas putida KT2440)
MLRISQEALTFDDILLVPGYSEVLPNEVSLKTRLTRGIELNIPLVSAAMDTVTEARLAIA
MAQEGGIGIIHKNMTIEQQAGEVRKVKKFEAGVVKDPITIDADATVRDLFELTRLNNISG
VPVLANGDLVGIVTSRDVRFENRLDAKVRDVMTPKERLVTVREGADKNEVRELLHKHRLE
KVLIVDDKFNLKGMMTVKDIEKAKAYPLASKDDQGRLRVGAAVGTGKDTGERVAALVAAG
VDVVVVDTAHGHSKGVIDRVRWVKETYPQVQVIGGNIATGAAAKALAEAGADAVKVGIGP
GSICTTRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLSKAIVAGASCVMMG
SMFAGTEEAPGEVELFQGRSYKAYRGMGSLGAMAQAQGSSDRYFQDSSAGAEKLVPEGIE
GRVPYKGALAAIIHQLMGGLRSSMGYTGSATIEEMRTKPEFVRITGAGMAESHVHDVQIT
KEAPNYRVG