Protein Info for PP_1025 in Pseudomonas putida KT2440

Annotation: 2-isopropylmalate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 TIGR00970: 2-isopropylmalate synthase" amino acids 7 to 548 (542 residues), 796.7 bits, see alignment E=5.7e-244 PF00682: HMGL-like" amino acids 33 to 313 (281 residues), 251.1 bits, see alignment E=1.8e-78 PF22615: IPMS_D2" amino acids 330 to 393 (64 residues), 116.4 bits, see alignment E=8.7e-38 PF08502: LeuA_dimer" amino acids 422 to 548 (127 residues), 97 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 100% identical to LEU1_PSEPK: 2-isopropylmalate synthase (leuA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01649, 2-isopropylmalate synthase [EC: 2.3.3.13] (inferred from 100% identity to ppf:Pput_1065)

Predicted SEED Role

"2-isopropylmalate synthase (EC 2.3.3.13)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 2.3.3.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P28 at UniProt or InterPro

Protein Sequence (557 amino acids)

>PP_1025 2-isopropylmalate synthase (Pseudomonas putida KT2440)
MTMLKDPSKKYRAFPTIDLPDRTWPSKTITQAPIWCSSDLRDGNQSLIEPMDSEKKLRFW
KTLVQVGVKEIEASFPSASQTDFDFVRTLIEDGHIPDDTTIQVLTQAREDLIARTFESLR
GAKKAIVHLYNATSPSFRRIVFNQDKQGVKDIAVNAAKLFVKYAAQQPETQWTFQYSPET
FSATEMEFAKEVCDAVIEVWNPTPEHKIILNLPATVEVSTPNIYADQIEWFCRNVSRRDS
VIISLHCHNDRGTGIAATELGLMAGADRAEGCLFGNGERTGNVDLVTLALNLYTQGIDPL
LDFSDIDGVRKVVEECNQLPVHPRHPYVGDLVHTAFSGSHQDAIRKGFAKQQDGELWEVP
YLPIDPADIGRSYEAVIRVNSQSGKGGITYLLEQEYGISLPRRMQIEFSQVVQGETDRLG
LEMTAQQIYSLLHKEYLQANAPYALVSHRLQEENGHSAVEVEVAGEGETTLHWRGKGNGA
LEALVAGLPIAVEIMDYNEHAIGAGTNAKAAAYIELRVAGGRPVHGVGIDENITTASFKA
LFSALNRSLSQQEAKAA