Protein Info for PP_1013 in Pseudomonas putida KT2440

Annotation: Sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 210 to 230 (21 residues), see Phobius details PF00672: HAMP" amino acids 229 to 277 (49 residues), 29.3 bits, see alignment 1.3e-10 PF00512: HisKA" amino acids 283 to 325 (43 residues), 35.4 bits, see alignment 1.4e-12 PF02518: HATPase_c" amino acids 379 to 481 (103 residues), 73 bits, see alignment E=4e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_1051)

Predicted SEED Role

"Integral membrane sensor signal transduction histidine kinase (EC 2.7.13.3), glucose catabolism cluster" (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P40 at UniProt or InterPro

Protein Sequence (484 amino acids)

>PP_1013 Sensor histidine kinase (Pseudomonas putida KT2440)
MSAVRPERRWRLLPRSLLGRMLLLTLLVVLLAQGLSSIIWVSQLRASQLQGLRASASSLA
HSMSASVSYFRSLPVAYRPLVLDQLRSMGGTRFFVSLNATPLDMQALPVTPRKQAVIDVF
QQVLHERLGSQMEISVEFVGPDDLRIFNSGLKLDELPRSWAHYSLTLEPLKPPVLVTQIR
LGEGEWLYIASLLPEPYTGLEAERLPRQQIGFIVLTTALLLLFIGLLVHWQSWPLKRLAR
AAREMSLGADVAPVAEAGGSEVVEVSRAFNSMRERISRYLTERSQLFSAISHDLRTPITR
LRLRVELLEDERLQAKFSQDLDELELLVKGALQCVKDTDIHENIEPVDLNQVLEILAEPY
LGDGRITVEGQALAPYPGKPLALRRCIGNLIDNAIKYGERARLRIIDGAEGFVLQVDDQG
PGVPQQQLEQVFEPHFRLAGQQQGYGLGLGIARNIAHSHGGEVSLLNLREGGLRVTLYLP
RGMD