Protein Info for PP_1001 in Pseudomonas putida KT2440

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01078: arginine deiminase
  • amino acids 10 to 415 (406 residues), 547.5 bits, E=8.4e-169
• PF02274: ADI
  • amino acids 38 to 412 (375 residues), 473.9 bits, E=4e-146
• PF19420: DDAH_eukar
  • amino acids 159 to 411 (253 residues), 36 bits, E=4.5e-13

Best Hits

Swiss-Prot: 100% identical to ARCA_PSEPK: Arginine deiminase (arcA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 100% identity to ppu:PP_1001)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

• L-arginine degradation XIII (reductive Stickland reaction) (5/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (2/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.6

Sequence Analysis Tools

See Q88P52 at UniProt or InterPro

Protein Sequence (417 amino acids)

>PP_1001 arginine deiminase (Pseudomonas putida KT2440)
MSAEKQKYGVHSEAGKLRKVMVCAPGLAHKRLTPSNCDELLFDDVIWVDQAKRDHFDFVT
KMRERGVDVLEMHNLLTDIVQNKEALKWILDRKITPDTVGVGLTNEVRSWLEGLEPRHLA
EFLIGGVAGQDLPQSEGADVVKMYNDYLGHSSFILPPLPNTQFTRDTTCWIYGGVTLNPM
YWPARRQETLLTTAIYKFHKEFTEADFQVWYGDPDKDHGNATLEGGDVMPIGNGIVLIGM
GERTSRQAIGQLAQNLFAKGAVKEVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVVKE
IVPFIIRPDESKPYGMDVRRINKSFIEVVGEQLGVQLRVVETGGNSFAAEREQWDDGNNV
VAIEPGVVIGYDRNTYTNTLLRKAGIEVITISAGELGRGRGGGHCMTCPIVRDPINY