Protein Info for PP_0987 in Pseudomonas putida KT2440

Annotation: L-serine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF03315: SDH_beta" amino acids 4 to 156 (153 residues), 202.9 bits, see alignment E=3.7e-64 TIGR00720: L-serine ammonia-lyase" amino acids 4 to 455 (452 residues), 716.4 bits, see alignment E=7.7e-220 PF03313: SDH_alpha" amino acids 187 to 452 (266 residues), 316.6 bits, see alignment E=1.5e-98

Best Hits

Swiss-Prot: 67% identical to SDHL_STRCO: L-serine dehydratase (sdaA) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to ppu:PP_0987)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P66 at UniProt or InterPro

Protein Sequence (458 amino acids)

>PP_0987 L-serine dehydratase (Pseudomonas putida KT2440)
MSLSVFDLFKIGIGPSSSHTVGPMRAAARFAEGLRRDGLLARTASVKAELYGSLGATGKG
HGSDKAVLLGLEGEHPDIIDTDSIPARLQVIRDSGHINLLGEHSIAFIEKQHLAMIRKPL
DYHPNGMIFRAFDDAGLQIRSREYYSVGGGFVVDEDAAGHDRIVEDTTVLAYPFKTAKAL
LGHCTAHDLSVSQVMLANESAWRPEAETRAGLLRIWQVMQDCVAAGCQHEGILPGGLKVK
RRAPALYRQLSGHPEASLRDALSVLDWVNLYALAVNEENAYGGRVVTAPTNGAAGIVPAV
LHYYMRFVPGASEDGVVRFLLTAAAIGILYKENASISGAEVGCQGEVGVACSMAAGALCE
VMGGSVQQVENAAEIGMEHNLGLTCDPIGGLVQVPCIERNAMGSVKAINAVRMALRGDGQ
HYVSLDKVIRTMRQTGADMKSKYKETARGGLAVNIIEC