Protein Info for PP_0982 in Pseudomonas putida KT2440

Annotation: Permease YjgP/YjgQ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 304 to 325 (22 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details signal peptide" amino acids 32 to 36 (5 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 2 to 354 (353 residues), 393.7 bits, see alignment E=2.8e-122 PF03739: LptF_LptG" amino acids 5 to 353 (349 residues), 236.3 bits, see alignment E=2.7e-74

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 100% identity to ppf:Pput_1019)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P71 at UniProt or InterPro

Protein Sequence (371 amino acids)

>PP_0982 Permease YjgP/YjgQ family protein (Pseudomonas putida KT2440)
MIVFRYLSREVLVTLSAVSAVLLVIIMSGRFIKYLAQAAQGVLDPGVLFLIMGFRLPGFL
QLILPLGLFLGILLAYGRLYLESEMTVLSATGMSQQRLLGMTMAPAALVALLVAWLSLSL
APLGVAQVQQIISQQDALTEFDTLVPGRFQTLRDGSRVTYTEQLSDDRINLGGVFISEKR
FNQDKTKDRAPSVLVAEKGHQEIQADGNRYLVLENGYRYDGNPGQADYRAIKYDTYGVLL
PKPEVAEEVTEREALPTSELIGKEGLRERAELQWRLSLPILVFVVTLLAVPLSRVNPRQG
RFLKLLPAILLYMAYLTMLISVRGALEKGKLPIALGMWWVHGLFLLIGLGLMYWEPLRLK
RAARRAEVAHG