Protein Info for PP_0959 in Pseudomonas putida KT2440

Annotation: phospholipid ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 13 to 263 (251 residues), 306.5 bits, see alignment E=8.7e-96 PF02405: MlaE" amino acids 50 to 261 (212 residues), 252.5 bits, see alignment E=1.6e-79

Best Hits

Swiss-Prot: 64% identical to MLAE_HAEIN: Intermembrane phospholipid transport system permease protein MlaE (mlaE) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 98% identity to ppw:PputW619_4256)

Predicted SEED Role

"Uncharacterized ABC transporter, permease component YrbE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P93 at UniProt or InterPro

Protein Sequence (266 amino acids)

>PP_0959 phospholipid ABC transporter (Pseudomonas putida KT2440)
MMRRKSLLERVRLLGRSAIDVLAVLGRSCLFLFHALVGRGGIGGGFQLLTKQLYSVGVLS
LAIVVVSGVFIGMVLALQGYSILTKYGSEQAVGQMVALTLLRELGPVVTALLFAGRAGSA
LTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPLLALIFSVVGIWGGSWVAV
DWLGVYEGSFWANMQNSVSFTDDVLNGLVKSVVFAFVSTWIAVFQGYDCEPTSEGISRAT
TKTVVYASLAVLGLDFILTALMFGDF