Protein Info for PP_0957 in Pseudomonas putida KT2440

Annotation: D-arabinose 5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF01380: SIS" amino acids 40 to 172 (133 residues), 115.5 bits, see alignment E=1.5e-37 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 45 to 314 (270 residues), 369 bits, see alignment E=8e-115 PF00571: CBS" amino acids 207 to 257 (51 residues), 27.1 bits, see alignment 4.4e-10 amino acids 270 to 321 (52 residues), 34.5 bits, see alignment 2.1e-12

Best Hits

Swiss-Prot: 82% identical to KDSD_PSEAE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 100% identity to ppu:PP_0957)

MetaCyc: 57% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.13

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88P95 at UniProt or InterPro

Protein Sequence (324 amino acids)

>PP_0957 D-arabinose 5-phosphate isomerase (Pseudomonas putida KT2440)
MSQSSELIQSAQRTLRLELEAVEALLARIDDNFVKACELILASKGRVVVVGMGKSGHIGN
KIAATLASTGTPAFFVHPAEASHGDMGMITRDDVILALSNSGSTAEIVTLLPFIKRLGIK
LISLTGNPDSPLAQAAEVNLDARVEQEACPLNLAPTSSTTAALVLGDALAIALLEARGFT
AEDFAFSHPGGALGRRLLLKVENVMHAGDDLPQVPRGTLLKDALLEMSHKGLGMTVIVEA
DGKLAGIFTDGDLRRSLDRNIDVHTTLIDQVMTVHGKTARADMLAAEALKIMEDHKINAL
VVVDREDRPTGALNMHDLLRAGVM