Protein Info for PP_0954 in Pseudomonas putida KT2440

Annotation: conserved exported protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03002: lipopolysaccharide transport periplasmic protein LptA
  • amino acids 24 to 170 (147 residues), 158.2 bits, E=5.8e-51
• PF03968: LptD_N
  • amino acids 35 to 146 (112 residues), 89.9 bits, E=7e-30

Best Hits

KEGG orthology group: K09774, lipopolysaccharide export system protein LptA (inferred from 99% identity to ppg:PputGB1_0961)

MetaCyc: 36% identical to LPS export ABC transporter substrate-binding protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"LptA, protein essential for LPS transport across the periplasm" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (1/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Sequence Analysis Tools

See Q88P98 at UniProt or InterPro

Protein Sequence (174 amino acids)

>PP_0954 conserved exported protein of unknown function (Pseudomonas putida KT2440)
MRLVKTLPLLLSLSAALGSASALALPNDRDQPIRIQADNAHLDDKQGVATYTGDVIITQG
SMMIKGNTVTITRSASGDIDVVTSVGNLAYFEQQQSAAKPDKMKGWGVTIQYQSQKDLVI
LTDRAKVESEGNTTEGEKIVYNTQTQVATAGRGGNVTTPRQRIDMVIQPKKKAE