Protein Info for PP_0942 in Pseudomonas putida KT2440

Annotation: regulatory protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 255 to 264 (10 residues), see Phobius details PF01523: PmbA_TldD_1st" amino acids 38 to 102 (65 residues), 48.9 bits, see alignment E=9.1e-17 PF19290: PmbA_TldD_2nd" amino acids 130 to 236 (107 residues), 77.6 bits, see alignment E=1.5e-25 PF19289: PmbA_TldD_3rd" amino acids 244 to 451 (208 residues), 228.6 bits, see alignment E=7.8e-72

Best Hits

Swiss-Prot: 50% identical to PMBA_ECO57: Metalloprotease PmbA (pmbA) from Escherichia coli O157:H7

KEGG orthology group: K03592, PmbA protein (inferred from 100% identity to ppu:PP_0942)

MetaCyc: 50% identical to metalloprotease subunit TldE (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PA8 at UniProt or InterPro

Protein Sequence (452 amino acids)

>PP_0942 regulatory protease (Pseudomonas putida KT2440)
MERTMSAVQSVGPKDLPALQEQVEAIIAEARRQGASACEVAVSLEQGLSTTVRQREVETV
EFNRDQGFGITLYVGQRKGSASTSASGPEAIRETVAAALAIARHTSEDECSGLADAALMA
REIPDLDLYHDWDIEPEKAIEMALACEAAAFDADPRILNADGTTLNTHQGCRVYGNSHGF
IGGYASTRHSLSCVMIAEGDGQMQRDYWYDVNRQGNLLADPSSIGLRAAQRAASRLGARP
VPTCEVPVLFSAELAGGLFGSFLSAISGGNLYRKSSFLEGTIGQRLFPSWLTLDERPHIP
RALGSAAFDGDGLATYAKPFVDKGELVSYLLGTYSGRKLGLPSTANSGGVHNLFVSHGVE
DQAALIRRMGRGLLVTELMGHGLNMVTGDYSRGAAGFWVENGEIQHAVQEVTIAGNMKDM
FQQIVAIGSDLETRSNIHTGSVLIERMTVAGS