Protein Info for PP_0935 in Pseudomonas putida KT2440

Annotation: Rod shape-determining protein MreD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 39 to 63 (25 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details PF04093: MreD" amino acids 5 to 151 (147 residues), 120 bits, see alignment E=5.3e-39 TIGR03426: rod shape-determining protein MreD" amino acids 9 to 154 (146 residues), 127.9 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: K03571, rod shape-determining protein MreD (inferred from 99% identity to ppg:PputGB1_0942)

Predicted SEED Role

"Rod shape-determining protein MreD" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PB5 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PP_0935 Rod shape-determining protein MreD (Pseudomonas putida KT2440)
MMAASRRNNGWVIWLTFAIGLLLSVSPMPQFMEVFRPMWLALLVSFWTLAVPNKVGMTTA
FVLGLAEDVLYGTLLGQNALVLTLITFLVLSLQQRLRMFPMWQQSLVILVIFGIAQLIQL
WLSALTGNRLPTLALVWSAVISALLWPWISFALRDLRRRLHIN