Protein Info for PP_0926 in Pseudomonas putida KT2440

Annotation: putative Membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 287 to 311 (25 residues), see Phobius details PF03547: Mem_trans" amino acids 15 to 137 (123 residues), 36.7 bits, see alignment E=9.9e-14 amino acids 166 to 303 (138 residues), 48.8 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to ppu:PP_0926)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PC4 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PP_0926 putative Membrane protein (Pseudomonas putida KT2440)
MRMLALLIQTLNITAPVFAMLFMGVLLKRIHLIDDNFNRVASQLVFNVCMPALLFLGIYH
ADLAAAVKPGVILYFIVATLVGFAIAWGMAIWRSPMADRGIYTQGAFRGNNGVIGLALAA
SLYGDYGISLGAVLAGLVILMYNSLSAVVLAVYSPDLKSDPWSICKSIFSNPLIISVLVA
APMAYGQVPLPNWLLTSGDYLAQMTLPLALICIGGTLSLAALRNCGRLAIDASFVKMLWL
PLLGTLGAWLCGFRGAELGILFLYIGSPTAAASYVMARAANGNHELAASIIVITTLMAAI
TTNIGIFILQWGGWI