Protein Info for PP_0918 in Pseudomonas putida KT2440

Annotation: putative 3-beta hydroxysteroid dehydrogenase/isomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 1 to 175 (175 residues), 29.1 bits, see alignment E=1.9e-10 PF05368: NmrA" amino acids 2 to 73 (72 residues), 34.2 bits, see alignment E=7.8e-12 PF01370: Epimerase" amino acids 3 to 227 (225 residues), 111.7 bits, see alignment E=1.4e-35 PF16363: GDP_Man_Dehyd" amino acids 4 to 248 (245 residues), 36 bits, see alignment E=2e-12 PF01073: 3Beta_HSD" amino acids 4 to 250 (247 residues), 97.6 bits, see alignment E=2.3e-31 PF13460: NAD_binding_10" amino acids 7 to 168 (162 residues), 55.1 bits, see alignment E=3.2e-18 PF07993: NAD_binding_4" amino acids 55 to 172 (118 residues), 50.4 bits, see alignment E=6.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0918)

Predicted SEED Role

"Nucleoside-diphosphate-sugar epimerases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PD2 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PP_0918 putative 3-beta hydroxysteroid dehydrogenase/isomerase family protein (Pseudomonas putida KT2440)
MRILVTGASGFIGGRFARFALEQGLDVRVSGRRAEGVEHLVKRGAQFIPGDLGDAELARR
LCQGVEAVVHCAGAVGNWGRYQDFYQGNVVVTENVVEGCLKEHVRRLVHLSSPSIYFNGP
SRLDVREDQVPRRFHDHYGQTKYLAEQKVFGAQEFGLEVLALRPRFVTGAGDASIFPRLM
QMQRKGRVAIIGNGLNKVDFTSVHNLNEALLSALFADDRALGQAYNISNGQPLPLWDVVN
YVMRQMQLPQVTRYRSYGLAYSLATLNEAACMLWPGRPQPTLSRLGMQVMSRDFTLDISR
ARQYLDYQPKVSLWTALDEFCGWWKHLPPG