Protein Info for PP_0900 in Pseudomonas putida KT2440

Annotation: PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details PF01569: PAP2" amino acids 97 to 228 (132 residues), 75.5 bits, see alignment E=1.7e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0900)

Predicted SEED Role

"PAP2 superfamily protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PF0 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PP_0900 PAP2 family protein (Pseudomonas putida KT2440)
MQQRTRPRPINYWLYLGIPLATAVALILLELTSVDMDVANLFFDPAAGQFIGRHSYLLEN
ILHDRVKQVVILLGVISLLTFAASFFWKRLFGWRRELGCLVLALGLSTAFVTPLKKVTQV
QCPWSLTQFGGTETYSKLLEPRPPTDKPGLCWPGGHAATGFCLFALFFLLRDRKPRLARV
AFVVALTAGSILSVGRMMQGAHFLSHNVWTAVFCWLIGLGSYYLVLYRRGLAEVPVAERS
AA