Protein Info for PP_0899 in Pseudomonas putida KT2440

Annotation: putative Ferredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 121 to 132 (12 residues), see Phobius details amino acids 193 to 209 (17 residues), see Phobius details PF00111: Fer2" amino acids 13 to 76 (64 residues), 59.1 bits, see alignment E=5.1e-20 PF00970: FAD_binding_6" amino acids 105 to 174 (70 residues), 21.2 bits, see alignment E=4.8e-08 PF00175: NAD_binding_1" amino acids 195 to 242 (48 residues), 25 bits, see alignment 3.9e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0899)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases" in subsystem Central meta-cleavage pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PF1 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PP_0899 putative Ferredoxin reductase (Pseudomonas putida KT2440)
MPEICVGERRWLVPIGSNLLDALNEAGLNVPYSCRAGSCHACLVRCLEGQPADALPEALA
LEKHAQGWRLACQCRVVEDLRVALYDPQQGGVPAQVCALDWFGDVLRLRLRPDRVVRYQA
GQHVVLWLGAVARPYSLASLPGEDDFLEFHIDCQRPGAFCDKARGLQVGDEMRLGEFRGG
ALHYDPDWQERPLWLLAAGTGLAPLWGILREALRRGHRGEIRVVHVARDPAGHYLAEKLL
KLPGVSVELVLVEHVDEALAGMRLLSRQTVALLCGAPGSVERFARRMFMAGVPRGQVFAD
VFVEHA