Protein Info for PP_0880 in Pseudomonas putida KT2440

Annotation: dipeptide ABC transporter - putative membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 106 to 132 (27 residues), see Phobius details amino acids 152 to 179 (28 residues), see Phobius details amino acids 199 to 219 (21 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 271 to 293 (23 residues), see Phobius details PF12911: OppC_N" amino acids 23 to 75 (53 residues), 59.1 bits, see alignment 3.1e-20 PF00528: BPD_transp_1" amino acids 122 to 305 (184 residues), 106.6 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 64% identical to DPPC_ECOLI: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli (strain K12)

KEGG orthology group: K12370, dipeptide transport system permease protein (inferred from 98% identity to ppw:PputW619_4298)

MetaCyc: 64% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PH0 at UniProt or InterPro

Protein Sequence (308 amino acids)

>PP_0880 dipeptide ABC transporter - putative membrane subunit (Pseudomonas putida KT2440)
MTSPIPKSVSPASPVDQSLLYPSPYKEFWQAFARNKGAVMGLAFMCLVVFCALFAPWVAP
HDPSEQYRDFLLTPPVWLEGGTWQFILGTDELGRDLLSRLIQGARLSLLIGLSSVVMSLI
PGILLGLLAGFFPQLLGPSIMRLMDVMLALPSLLLAVAIVAILGPGLINTVIAIAIVSLP
SYVRLTRAAVMGELNRDYVTAARLAGAGLPRLMFVTVLPNCMAPLIVQATLSFSSAILDA
AALGFLGLGVQPPTPEWGTMLASARDYIERAWWVVSLPGLTILLSVLAINLMGDGLRDAL
DPKLKNAA