Protein Info for PP_0870 in Pseudomonas putida KT2440

Annotation: putative Glycine betaine/carnitine/choline ABC transporter, periplasmic binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF04069: OpuAC" amino acids 37 to 305 (269 residues), 222.3 bits, see alignment E=4.2e-70

Best Hits

Swiss-Prot: 43% identical to OSMX_SALTY: Osmoprotectant-binding protein OsmX (osmX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05845, osmoprotectant transport system substrate-binding protein (inferred from 100% identity to ppu:PP_0870)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) / Osmotic adaptation" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PI0 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PP_0870 putative Glycine betaine/carnitine/choline ABC transporter, periplasmic binding protein (Pseudomonas putida KT2440)
MAWPNKDRKRMKKRIALLLGAALLFAGFAQAAEKPLIRIGARVFTEQTVLAEITAQYLRA
NGFDVRVIGGLGSSLARQAQETGQLDLMWEYTGVSLVSYNHIDERMPSAEATYAKVKELD
AKKDLIWLTPSKFSNTYALGLPKQVAEAYPQINSISDLNQVLRDERKRNHLVALDTEFAN
RPDGLVGLKEMYDLQVGRANIRQMDAGLVYTAMHNNQVFAGLVYTTDGRLSAFNLKLLED
DKHYFPDYTAAPVVRKAVLDANPQLVALLKPLAEQLDDETMRQLNAKVDVDHQNPTAVAA
AFLREHPLKEVQP