Protein Info for PP_0865 in Pseudomonas putida KT2440

Annotation: ECF subfamily RNA polymerase sigma-24 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 7 to 157 (151 residues), 80.6 bits, see alignment E=5.2e-27 PF04542: Sigma70_r2" amino acids 9 to 72 (64 residues), 37.8 bits, see alignment E=2.7e-13 PF07638: Sigma70_ECF" amino acids 22 to 148 (127 residues), 38.8 bits, see alignment E=1.9e-13 PF08281: Sigma70_r4_2" amino acids 102 to 153 (52 residues), 50.2 bits, see alignment E=3.3e-17 PF04545: Sigma70_r4" amino acids 106 to 155 (50 residues), 35.8 bits, see alignment E=9.1e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to ppf:Pput_0895)

Predicted SEED Role

"FIG006045: Sigma factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PI5 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PP_0865 ECF subfamily RNA polymerase sigma-24 factor (Pseudomonas putida KT2440)
MSGHKGFLDHYHELIGTWTRKLRSRQQAEDLTHDAFVRVLETPREQVEQPRAYLHQAARN
IAVDGFRREDRRQALEREAFEEGATGSGDPEAYVHALELADSVERALAELPLNCRQVFIW
QKLEGLTQAEIAERMGLSKNMVEKYMIRTLRHLREHLDVSA