Protein Info for PP_0861 in Pseudomonas putida KT2440

Annotation: outer membrane ferric siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 763 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF07715: Plug" amino acids 71 to 170 (100 residues), 85 bits, see alignment E=7.7e-28 TIGR01783: TonB-dependent siderophore receptor" amino acids 73 to 763 (691 residues), 290.2 bits, see alignment E=1.9e-90 PF00593: TonB_dep_Rec_b-barrel" amino acids 269 to 732 (464 residues), 214.3 bits, see alignment E=9.5e-67 PF14905: OMP_b-brl_3" amino acids 567 to 741 (175 residues), 32.7 bits, see alignment E=6.4e-12

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to ppu:PP_0861)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PI9 at UniProt or InterPro

Protein Sequence (763 amino acids)

>PP_0861 outer membrane ferric siderophore receptor (Pseudomonas putida KT2440)
MRQYVPSAVSSPRLIVPAIGVALSASSVYAADPAANSAITLDATSVNGKAEQASTDYKVE
KAASQKYTAPLVDTPRSVTVIPQQVIKDTNALTLQDALRTVPGITFGAGEGGNPQGDRPF
IRGFDAQGDTYLDGVRDTGAQTREIFAIESVEVAKGPNSAIGGRGAAGGTINLVSKRAHL
GNSLDGAWTWGSDQTQRYTFDGNYQFSDTVAGRLNLMTHESNVAGRDKVNYDRWGIAPSL
AFGLGTPTRVNLDYYHLESDDLPDSGIPYTIPTNGSAGRTSAHPSKPNDGGDSDNFYGLT
GRDFRKTRVDIATFAVEHDLTDSLTIKNTLRHGNSMQDYILTQPDDSKGNVNNGSVWRRA
NTRVGNTATTTNQTDLFGEFYVGGMKNSFSTGIELSREESERSSYTVDTDTVPGGSANSN
CTPGMIGATSGYNCTSLSNPNPDDPWNGAISRNYAGTTTNSKTRAIYVFDTLELTPEWLV
NMGLRYDHFDTDYKTYNAAGTTTAKGKDVSEFVTGQLGLVWKPAENGSIYVSYATSATPP
GAMLGEGTEGNPLGGTPDRNGNLLASDMEPEETTNYEIGTKWDLLDQRLSLTAALFRTEK
ENARVQVDTTTYENVGETRVQGIELSASGKLTDKWQVFAGYTYMQARQIDGGPLGKANDG
NQLPNTPNNSASLWTTYSITPKLTVGGGAFYVDDVYGSVANTTMVDSYVRYDAMAAYKLT
KNVDLQLNVQNLTNEVYYDKAFSTHFANQAAGRTALLTTSVHF