Protein Info for PP_0857 in Pseudomonas putida KT2440

Annotation: GTPase Der

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 448 (446 residues), 582 bits, see alignment E=1.3e-178 TIGR00231: small GTP-binding protein domain" amino acids 4 to 158 (155 residues), 77.7 bits, see alignment E=1.4e-25 amino acids 192 to 358 (167 residues), 86.3 bits, see alignment E=2.9e-28 PF02421: FeoB_N" amino acids 5 to 157 (153 residues), 56.9 bits, see alignment E=8.9e-19 amino acids 194 to 355 (162 residues), 50.2 bits, see alignment E=1.1e-16 PF01926: MMR_HSR1" amino acids 5 to 119 (115 residues), 101.9 bits, see alignment E=1.2e-32 amino acids 194 to 312 (119 residues), 94.9 bits, see alignment E=1.7e-30 PF00009: GTP_EFTU" amino acids 35 to 163 (129 residues), 26.9 bits, see alignment E=1.7e-09 amino acids 193 to 362 (170 residues), 38.6 bits, see alignment E=4.3e-13 PF14714: KH_dom-like" amino acids 368 to 448 (81 residues), 97 bits, see alignment E=3.3e-31

Best Hits

Swiss-Prot: 100% identical to DER_PSEPK: GTPase Der (der) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to ppu:PP_0857)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PJ3 at UniProt or InterPro

Protein Sequence (487 amino acids)

>PP_0857 GTPase Der (Pseudomonas putida KT2440)
MVPVIALVGRPNVGKSTMFNRLTKTRDAIVGDLSGLTRDRQYGDASWQGRSFILIDTGGI
TGDEVGMDEKMAEQSLMAIEEADYVLFLVDARAGMTAADQMIAEHLRKRNKAAILVANKI
DNIDPDVARAEFSPMGMGNAIPVAGSQGRGINALMEAVLGHLPRDAEEEALEQDVAEGEE
AVRIPGPSEKDGIKIAIIGRPNVGKSTLVNRMLGEERVVVYDEPGTTRDSIYIPFERDGE
KYTFIDTAGVRKRGKIHEEVEKFSVVKTLQAIKDANVVIFVMDAREGVVDHDLNLLGFAL
EAGRAIVIALNKWDGMEPGERAYVKTELERRLFFVDFADIHFISALHGTGVGNLYKSVQA
AFQSAVTRWPTSRLTQILEDAVSEHQPPMVNGRRIKLRYAHLGGANPPLIVIHGNQTDSI
PKSYSRYLENTYRRVLKLVGTPIRIEYKGGENPYEGKKNTLTDRQVNKKRRLMSHHKKAE
KKRRDKR