Protein Info for PP_0856 in Pseudomonas putida KT2440

Annotation: conserved lipoprotein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 5 to 377 (373 residues), 448.8 bits, see alignment E=6.2e-139 PF01011: PQQ" amino acids 67 to 100 (34 residues), 24.9 bits, see alignment 1.9e-09 amino acids 109 to 143 (35 residues), 26.9 bits, see alignment 4.3e-10 amino acids 147 to 179 (33 residues), 23.8 bits, see alignment 4.1e-09 PF13360: PQQ_2" amino acids 75 to 306 (232 residues), 183.8 bits, see alignment E=6.4e-58 amino acids 289 to 378 (90 residues), 20.9 bits, see alignment E=3.8e-08 PF13570: PQQ_3" amino acids 126 to 165 (40 residues), 30.6 bits, see alignment 5.2e-11

Best Hits

Swiss-Prot: 71% identical to BAMB_PSEAE: Outer membrane protein assembly factor BamB (bamB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_0886)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PJ4 at UniProt or InterPro

Protein Sequence (380 amino acids)

>PP_0856 conserved lipoprotein of unknown function (Pseudomonas putida KT2440)
MIGWKHAAVLTLAVLAAGCSSNSKKELPPAELTKFTEEVVLKKQWSRSIGDGQGETYNTL
VPAIENDRIYASDVNGEVFALDRITGDVVWKKDLELQVSGAVGVGYGLVMLGTLKGEVIA
LDSSTGEERWRSRVTSEVLAPPANNGDVVVVQTQDDRLIGLDAATGDRRWIYENSPAVLT
LRGTGAPIATNRLAVAGLSTGKVVAVDINNGVPVWESRVAIPKGRSELDRVVDIDGGLLL
SGGTLYVSTYQGRVAGLDLESGRELWQRDASSYVGVAQGFGNVYVSEASGTVESVDERSS
SALWSNDSMARRQLTAPEVFSSYVAVGDFEGYLHLLSQVDGRFVGRERIDSDGLRARPLV
VGDTIYVFGNSGKLEALTIR