Protein Info for PP_0851 in Pseudomonas putida KT2440

Annotation: Type IV pili biogenesis protein PilF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 10 to 242 (233 residues), 237.5 bits, see alignment E=7.5e-75 PF13181: TPR_8" amino acids 40 to 71 (32 residues), 13.3 bits, see alignment 3.8e-05 amino acids 144 to 174 (31 residues), 19.4 bits, see alignment 4e-07 PF13432: TPR_16" amino acids 44 to 100 (57 residues), 20.5 bits, see alignment E=2.4e-07 amino acids 149 to 203 (55 residues), 17 bits, see alignment E=3.1e-06 PF14559: TPR_19" amino acids 85 to 135 (51 residues), 29.3 bits, see alignment 3.9e-10 PF13374: TPR_10" amino acids 109 to 133 (25 residues), 15.2 bits, see alignment (E = 8.3e-06)

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 100% identity to ppu:PP_0851)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PJ9 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PP_0851 Type IV pili biogenesis protein PilF (Pseudomonas putida KT2440)
MPMSLRAALSILALSLLAGCVSGGASDPLASRQGRVEAGRAYVQLGLGYLQQGLTEQAKA
PLGKALALDDQDVDAHAALAVVFQAQGEPALAEAHFRKALLISRGDTRIRNNYGSFLYAQ
GRFAEAKQMFRLASADTLYPERSRVYENLGLTALKLERRDQAHAYLLKALQLNQRQPKAL
LEMAELSYENRHYVPARDYYDRFSQLSDHDARSLLLGSRLARVFDEQGTLAELGQQLQRL
YPGTPEYQQYLSEQR