Protein Info for PP_0845 in Pseudomonas putida KT2440

Annotation: DnaJ-like molecular chaperone specific for IscU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF00226: DnaJ" amino acids 6 to 73 (68 residues), 30.1 bits, see alignment E=4.3e-11 TIGR00714: Fe-S protein assembly co-chaperone HscB" amino acids 16 to 171 (156 residues), 109.6 bits, see alignment E=7.7e-36 PF07743: HSCB_C" amino acids 90 to 164 (75 residues), 60.6 bits, see alignment E=1.6e-20

Best Hits

Swiss-Prot: 100% identical to HSCB_PSEPK: Co-chaperone protein HscB homolog (hscB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 99% identity to ppf:Pput_0875)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PK5 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PP_0845 DnaJ-like molecular chaperone specific for IscU (Pseudomonas putida KT2440)
MGTPCHYALFDLQPSFRLDLDKLATRYRELAREVHPDRFADASEREQRIALEKSAALNDA
YQTLRSAPRRARYLLAISGHEVPQEVTVHDPDFLLQQMQWREELEELQDEADLDGVGVFK
KRLKAAQDTLNEDFAGCWDAPGERDKAERLMRRMQFLDKLAQEVRQLEERLDD