Protein Info for PP_0825 in Pseudomonas putida KT2440

Annotation: phosphonates import ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00005: ABC_tran" amino acids 23 to 178 (156 residues), 102.9 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 100% identical to PHNC_PSEPK: Phosphonates import ATP-binding protein PhnC (phnC) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 100% identity to ppu:PP_0825)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PM5 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PP_0825 phosphonates import ATP-binding protein (Pseudomonas putida KT2440)
MTASNAAIHLYGASLRHGQVRALDAVSLRIAQGERVAIIGPSGAGKSSLLHLMATAIQPS
SGRLELLGEQPWALSARARQRLRARVGLVHQSPPLPPRQRVVTAVLAGRLGQWGTLRGLL
NLLYPSDVPGARQVLAELGLADKLFVQCGQLSGGQLQRVGIARALYQRPQVLLTDEPVSA
MDPVLADHSLALLNRHAQATGVTLVASLHAVELALAHFPRVIGIREGQVVFDCPAEAVTE
QLLDALYANEQLAPPPTQGPTLTVQIPRC