Protein Info for PP_0824 in Pseudomonas putida KT2440

Annotation: phosphonate transport system-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 7 to 243 (237 residues), 241.9 bits, see alignment E=7.5e-76 TIGR04553: putative selenate ABC transporter periplasmic binding protein" amino acids 26 to 284 (259 residues), 367.4 bits, see alignment E=4e-114 PF12974: Phosphonate-bd" amino acids 30 to 270 (241 residues), 238.6 bits, see alignment E=7.4e-75 PF00497: SBP_bac_3" amino acids 49 to 243 (195 residues), 28.7 bits, see alignment E=9.7e-11

Best Hits

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 99% identity to ppf:Pput_0851)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PM6 at UniProt or InterPro

Protein Sequence (284 amino acids)

>PP_0824 phosphonate transport system-binding protein (Pseudomonas putida KT2440)
MLNRPLALAAGLVLSCCAAVVQAAETLRVSAIPDEAPTELQRKFKPLGEYLAKQLGMEVK
FVPVADYPAVVESLAADRLDLAWLGGFTFVQVHLKDPTATPLVQREQDAQFTSKFITANP
DVKSLSDLKGKSFAFGSISSTSGSLMPRYFMLKQDNIKPEEYFSRVAYSGAHDATVAWVQ
AGKVDGGVLNASVWQKLVDAGKVDTTKVKVFATTPTYFDYNWTVRGNMDPALKQKIKKAF
LDLDPSNPEHKAILDLQAASRFIETKPENYKGTEQAAREAGLLK