Protein Info for PP_0823 in Pseudomonas putida KT2440

Annotation: Selenide, water dikinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR00476: selenide, water dikinase" amino acids 6 to 311 (306 residues), 446.2 bits, see alignment E=3.1e-138 PF00586: AIRS" amino acids 49 to 156 (108 residues), 97.7 bits, see alignment E=5.6e-32 PF02769: AIRS_C" amino acids 169 to 343 (175 residues), 70.6 bits, see alignment E=1.8e-23

Best Hits

Swiss-Prot: 100% identical to SELD_PSEPK: Selenide, water dikinase (selD) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01008, selenide, water dikinase [EC: 2.7.9.3] (inferred from 100% identity to ppu:PP_0823)

MetaCyc: 65% identical to selenide, water dikinase (Escherichia coli K-12 substr. MG1655)
Selenide, water dikinase. [EC: 2.7.9.3]

Predicted SEED Role

"Selenide,water dikinase (EC 2.7.9.3)" in subsystem Selenocysteine metabolism (EC 2.7.9.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.9.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P59392 at UniProt or InterPro

Protein Sequence (344 amino acids)

>PP_0823 Selenide, water dikinase (Pseudomonas putida KT2440)
MSEPIRLTQYSHGAGCGCKISPKVLDVILAESGTQALDPKLWVGNASRDDAAVYALDDER
GVVSTTDFFMPIVDDPYDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLPPEVAREV
IRGGRAVCAEAGIPLAGGHSIDAPEPIFGLAVTGVVSKRHLKRNDTASAGCQLYLTKPLG
IGILTTAEKKAKLRVQDQGLARDWMCTLNTPGSRFGKLDGVKAMTDVTGFGLLGHLVELA
EGSGLTAHLNYAAVPRLPSVDHYLAEGCIPGGTLRNYDSYGHKISALSDDQKHLLCDPQT
SGGLLVAVAPEGEAEFLAVAAELGLKLSPIGKLVERQSHAVEVI