Protein Info for PP_0807 in Pseudomonas putida KT2440

Annotation: DNA-binding transcriptional dual regulator (NO)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01590: GAF" amino acids 25 to 159 (135 residues), 47.4 bits, see alignment E=1.3e-15 PF13185: GAF_2" amino acids 25 to 159 (135 residues), 31.7 bits, see alignment E=7.7e-11 PF00158: Sigma54_activat" amino acids 193 to 359 (167 residues), 235.3 bits, see alignment E=1.5e-73 PF14532: Sigma54_activ_2" amino acids 194 to 364 (171 residues), 66 bits, see alignment E=2.1e-21 PF07728: AAA_5" amino acids 217 to 335 (119 residues), 32.2 bits, see alignment E=4.4e-11 PF25601: AAA_lid_14" amino acids 365 to 424 (60 residues), 56.6 bits, see alignment E=8.4e-19

Best Hits

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 100% identity to ppu:PP_0807)

Predicted SEED Role

"Anaerobic nitric oxide reductase transcription regulator NorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PP1 at UniProt or InterPro

Protein Sequence (518 amino acids)

>PP_0807 DNA-binding transcriptional dual regulator (NO) (Pseudomonas putida KT2440)
MTTQPLLTTLLPLVSDLSRDLPDQERYRRLLQAMRGLLPCDAAALLRLDGEWLVPLAVDG
LSPDTLGRRFRVSEHPRFQILLSRPEPTRFASDSELPDPYDGLVNAPDADLEVHDCMGCP
LMVDERPWGLVTLDALTPGQFQSLELDALQAFASLAAATVTVAERIEHLALRAEDEHHRA
ELYRQASGQDRELIGQSPAHKRLVEEIRLVGSSDLTVLITGETGVGKELVAQALHRASSR
ADKPLVSLNCAALPDTLVESELFGHVRGAFTGAHGERRGKFELANGGTLFLDEVGELPLT
VQAKLLRVLQSGQLQRLGSDREHRVDVRLIAATNRDLAAEVRTGNFRADFYHRLSVYPLH
VPPLRERGRDVLLLAGYFLEQNRSRLGLNSLRLSHEAQAALIAYDWPGNVRELEHLIGRS
ALKALGQHPDRPRILTLEAIDLDLRVSATTPGTLPSPAAPLQVVTPPEGGLREAVDSYQR
QVIEACLQRHQDNWAAAARELGLDRANLSRLARRLGLR