Protein Info for PP_0799 in Pseudomonas putida KT2440

Annotation: histidine-specific outer membrane porin D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03573: OprD" amino acids 30 to 442 (413 residues), 488.6 bits, see alignment E=7.7e-151

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_0822)

Predicted SEED Role

"Outer membrane porin, coexpressed with pyoverdine biosynthesis regulon" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PP9 at UniProt or InterPro

Protein Sequence (444 amino acids)

>PP_0799 histidine-specific outer membrane porin D (Pseudomonas putida KT2440)
MPSAFRFTPLFIALTATIPFAAQADEDKADGFIEGSSFNLHFRNAYFNRDNHNAGVRDTR
EWGQGAVARFESGYTPGVVGFGLDAHAMLGLKLDGGGGHAGTSILPEHIKDDGELGAAPH
SFSTAGAAVKLKAFDTELKAGDLFLTNPVIAGGETRMLPQTFRGVSLTNTSIDGLLLEGG
QVSFTHPYNQSGHRRIDTYYGSLDEHDKSKHLNWAGASWSGTEHITANLYAAELKDIWNQ
YYADFDYTYVVNDLVSLNPGVHFYHTQDTGQALLGKIDNNTYSVHFTVNAGFHSVTAAYQ
RVNGNTPFDYINLGDSVYLDNSRMYSDFNAPNERSWKLQYGYDFAGVGVPGLSTSLSYSR
GEADLTKATQDTTHYDYYREDGKNAMHWERDLDVKYVFQEGDLKDLSVLVRYATHRGSQG
YASIDSNSDNDELRVIVDYPLNVF