Protein Info for PP_0792 in Pseudomonas putida KT2440

Annotation: catabolite repressor-activator, DNA-binding transcriptional dual regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR02417: D-fructose-responsive transcription factor" amino acids 2 to 327 (326 residues), 509.4 bits, see alignment E=2.2e-157 PF00356: LacI" amino acids 3 to 50 (48 residues), 55.7 bits, see alignment 6.9e-19 PF00532: Peripla_BP_1" amino acids 62 to 215 (154 residues), 60.2 bits, see alignment E=4.6e-20 PF13407: Peripla_BP_4" amino acids 65 to 311 (247 residues), 53.4 bits, see alignment E=5.6e-18 PF13377: Peripla_BP_3" amino acids 179 to 328 (150 residues), 26.8 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 47% identical to CRA_ECO57: Catabolite repressor/activator (cra) from Escherichia coli O157:H7

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 100% identity to ppu:PP_0792)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PQ6 at UniProt or InterPro

Protein Sequence (331 amino acids)

>PP_0792 catabolite repressor-activator, DNA-binding transcriptional dual regulator (Pseudomonas putida KT2440)
MKLSDIARLAGVSVTTASYVINGKAEQQRISNSTVERVRAVVEAHGFTPNPQAAGLRSRH
TRTLGFILPDLENPSYARIAKQLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDA
LFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVISDDRDASRQLAASLLSSAPR
SIALIGARPELSVSQARAGGFDEALQGYTGEVRRYQGEAFSRECGQRLMQQLIDDLGGLP
DALVTTSYVLLQGVFDTLQARPVDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATA
LELALAAIEEKRYEPGVHAVGRTFKQRISVA