Protein Info for PP_0790 in Pseudomonas putida KT2440

Annotation: Inner membrane protein AmpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details PF17113: AmpE" amino acids 1 to 205 (205 residues), 41 bits, see alignment E=8.1e-15

Best Hits

KEGG orthology group: K03807, AmpE protein (inferred from 100% identity to ppu:PP_0790)

Predicted SEED Role

"AmpE protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PQ8 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PP_0790 Inner membrane protein AmpE (Pseudomonas putida KT2440)
MSFLVLLLALWVEKFSALRHQVQRDGFFIGELVRLERNGKVHPWWTLAILVLAPVALLVL
LLHVLEPVAYGLLALPVHLLVLIYSLGRGDAKASLGAFRDAWRRGDDQAALHAAERDLGL
VADEPHSLLVRVQGNLLWQVYQGFFAVIFWYFVLGPGAALAYRLLALCSEHSKQPALKAR
AEQLRHIMDWLPVRALALSFALVGNFLAVTRVMLHEVLNWHISAGHLVARVGRIADDIPE
EEDSQRGLGRLDSLWELLLRCAVLWYAGFALWTVLV