Protein Info for PP_0771 in Pseudomonas putida KT2440
Annotation: mRNA interferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to CHPB_ECOLI: Endoribonuclease toxin ChpB (chpB) from Escherichia coli (strain K12)
KEGG orthology group: K07171, (no description) (inferred from 100% identity to ppu:PP_0771)MetaCyc: 54% identical to endoribonuclease toxin ChpB (Escherichia coli K-12 substr. MG1655)
RXN-19924 [EC: 4.6.1.19, 4.6.1.22]
Predicted SEED Role
"Programmed cell death toxin ChpB" in subsystem MazEF toxin-antitoxing (programmed cell death) system
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.6.1.19 or 4.6.1.22
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q88PS7 at UniProt or InterPro
Protein Sequence (115 amino acids)
>PP_0771 mRNA interferase (Pseudomonas putida KT2440) MKRLKFARGDIVRVNLDPTVGREQQGSGRPALVLTPAAFNASGLAVIIPITQGGDFARHA GFAVTLSGAGTQTQGVMLCNQVRTVDLEARFAKRIESVPEAVILDALARVQTLFD