Protein Info for PP_0727 in Pseudomonas putida KT2440

Annotation: conserved protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF07722: Peptidase_C26" amino acids 14 to 121 (108 residues), 45.9 bits, see alignment E=6.1e-16 amino acids 129 to 179 (51 residues), 39.3 bits, see alignment E=6.6e-14 PF00117: GATase" amino acids 53 to 181 (129 residues), 43.1 bits, see alignment E=4e-15

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 100% identity to ppu:PP_0727)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PX1 at UniProt or InterPro

Protein Sequence (200 amino acids)

>PP_0727 conserved protein of unknown function (Pseudomonas putida KT2440)
MILVGMTMLRQFNAERQEWRDALDQRWVEFLDQCGLTPLYLPNDPRVSMALVQSLRPQGL
LLTGGGSCQALSGTADTRDVTERVLLDLAENLRLPVLGVCRGMQVMLTRAGGTLERLAGH
VGEHMINMQEQRRRVNSYHEYGFREAPDGYRVLALADDGVIEAVYDDHRRHTGIMWHPER
ELPADPLDIQRVRHAFGAFS