Protein Info for PP_0720 in Pseudomonas putida KT2440

Annotation: Peptidyl-tRNA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 TIGR00447: aminoacyl-tRNA hydrolase" amino acids 5 to 190 (186 residues), 214.6 bits, see alignment E=5e-68 PF01195: Pept_tRNA_hydro" amino acids 6 to 190 (185 residues), 213.1 bits, see alignment E=1.6e-67

Best Hits

Swiss-Prot: 100% identical to PTH_PSEPK: Peptidyl-tRNA hydrolase (pth) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01056, peptidyl-tRNA hydrolase, PTH1 family [EC: 3.1.1.29] (inferred from 99% identity to pen:PSEEN0855)

MetaCyc: 64% identical to peptidyl-tRNA hydrolase (Escherichia coli K-12 substr. MG1655)
Aminoacyl-tRNA hydrolase. [EC: 3.1.1.29]

Predicted SEED Role

"Peptidyl-tRNA hydrolase (EC 3.1.1.29)" (EC 3.1.1.29)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PX8 at UniProt or InterPro

Protein Sequence (194 amino acids)

>PP_0720 Peptidyl-tRNA hydrolase (Pseudomonas putida KT2440)
MTAIQLIVGLGNPGPEYEQTRHNAGALFVERLASAQRVSLTADKKYFGLTAKFSHQGNDV
RLLIPTTYMNRSGQSVAALANFFRIKPEAILVAHDELDLPPGVAKLKRGGGHGGHNGLRD
IIAQLGNQNDFHRLRLGIGHPGDAKLVSNFVLGRAPRAEQEKLDASIDFALGVLPDVLAG
DFAKAMRELHSQKA