Protein Info for PP_0717 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function, DUF2955 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 12 to 43 (32 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 248 to 264 (17 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details PF11168: DUF2955" amino acids 9 to 149 (141 residues), 123 bits, see alignment E=4.4e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0717)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PY1 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PP_0717 conserved membrane protein of unknown function, DUF2955 family (Pseudomonas putida KT2440)
MPIELRRLRALRLAWGVALCLAVSFGIGLPVPILAPVFAVLLLAMRSQPLPLRAAPALAL
LVLLACGSGLLLIPLLRHAPLAGVLLVGVGVFLTLRYALKGGNGLLANLLVVGLTMIAAA
GTSDFTLALSVVEALAKGMLLAVLGTSVVHTLFPEPANAPAPPVPPLLGSEHVSWVALRA
TLIVMPAFLLALIAPDQYMPLIMKAVSVGQQAGETRARHASRELIGSTLLAGVLAIALWV
ALSLFVHLWMFFLWVLLFALWQARRLYQAVPSRQSPAYWVSCLTTMLILLGQSVQDSAGG
QDVYKAFAVRMALFLAVSVYASAMLIWIDRLRSRRGLLRG