Protein Info for PP_0712 in Pseudomonas putida KT2440

Annotation: polyphosphate kinase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR03707: polyphosphate kinase 2" amino acids 18 to 242 (225 residues), 353.3 bits, see alignment E=3.1e-110 PF03976: PPK2" amino acids 19 to 241 (223 residues), 311.3 bits, see alignment E=2.1e-97

Best Hits

Swiss-Prot: 59% identical to PK21C_RHIME: Polyphosphate:ADP phosphotransferase 3 (SMa0670) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0712)

Predicted SEED Role

"FIG00953609: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88PY6 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PP_0712 polyphosphate kinase 2 (Pseudomonas putida KT2440)
MSKPSRKPPKKQPEKLGGKAYEKALKNLHVELVKLQEWVVAKGLKVCIVFEGRDGAGKGG
TIKAITERVSPRVFRVVALPAPTEREKTQMYVQRYLGHLPAAGEVVIFDRSWYNRAGVER
VMGFCSGEQVDKFLTGVPGFERVMVDSGIILIKYWLEVSADEQTRRLQDRINDGRKLWKL
SPMDLKSYSRWDEYTQARDEMFQASDTAWAPWFMANSNDKRRARLNIISHLLSRIPYKDI
TRDQQVKLPKRGKIGKYKAVAYPFKFVEERF