Protein Info for PP_0670 in Pseudomonas putida KT2440

Annotation: Transporter, bile acid/Na+ symporter family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 230 to 253 (24 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details PF13593: SBF_like" amino acids 16 to 291 (276 residues), 46.7 bits, see alignment E=2.7e-16 PF01758: SBF" amino acids 41 to 222 (182 residues), 61.1 bits, see alignment E=1.2e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0670)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q28 at UniProt or InterPro

Protein Sequence (317 amino acids)

>PP_0670 Transporter, bile acid/Na+ symporter family (Pseudomonas putida KT2440)
MTREQLETRQIPIYFAAVLAAIAFGLLASDAARQLEALITPAIAVLMYAMFLQIPFLNLR
QGLGNRRFITALLLANFILVPLLVWAITRGLVEHPAILVGALLVLLTPCIDYVVVFTHIG
KGDSRLTLSATPLLLLAQLVLLPVYLALMLGGSSQVAISITPFLEAFVLLIVLPMALAVL
TSAGARRSRAVATWNDAWAWLPVPAMALVLMVVIASQIDVVLRDFDRLLPVIPVYIGFML
LAPVLGFICARLLRLPASEARSVTFSAATRNSLVVLPLALALPEEMRGLAAAAVITQTLV
ELVSELIYVRAVPRLVR