Protein Info for PP_0659 in Pseudomonas putida KT2440

Annotation: Cystathionine gamma-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF01053: Cys_Met_Meta_PP" amino acids 17 to 396 (380 residues), 433.7 bits, see alignment E=6.8e-134 PF00155: Aminotran_1_2" amino acids 72 to 237 (166 residues), 38.2 bits, see alignment E=1.6e-13 PF00266: Aminotran_5" amino acids 73 to 241 (169 residues), 24.9 bits, see alignment E=1.5e-09

Best Hits

Swiss-Prot: 45% identical to MEGL_FUSNN: L-methionine gamma-lyase (FN1419) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 100% identity to ppu:PP_0659)

MetaCyc: 42% identical to O-succinyl-L-homoserine sulfhydrylase (Pseudomonas aeruginosa PAO1)
Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.48

Use Curated BLAST to search for 2.5.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q39 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PP_0659 Cystathionine gamma-synthase (Pseudomonas putida KT2440)
MNNNEKFEGNAAAGVGTRVVWSGEQVQHPYNATQTPIVVSAAYGYNDIDAWYDVAQGKQP
GFIYSRMSNPTVATLEAKLAELEQAESAVAFSSGMAAISAVLHTFLSNGKRVVSTRDSYG
GTNKIFEEFLPRMGVQVCLCDTLDTEALEREIAAGCDLLYLETPTNPTLKVLDIRRLSAA
AHKVGALVVADNTFATPLNQNPLALGVDVVVHSATKFLSGHGDVLGGVVCGAEALMAQVR
HYREINGAALDPFSAYLIIRGIKTLAVRLRQQQASAMALAHYLSTEPLVEAVNYPGLPAH
AGHAIAKAQMRGFGAIVSFVLKGGMPTVARLLPRLKYAHRAGNLGAVETIYGPARTTSHV
ENTLEERLALGISEGLVRISVGIEETDDLLADLAQACASVREELAVAKELHADADACQSP
VQA