Protein Info for PP_0618 in Pseudomonas putida KT2440

Annotation: Branched-chain amino acid ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 223 to 251 (29 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 9 to 274 (266 residues), 125.8 bits, see alignment E=9e-41

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to ppg:PputGB1_0664)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q77 at UniProt or InterPro

Protein Sequence (286 amino acids)

>PP_0618 Branched-chain amino acid ABC transporter, permease protein (Pseudomonas putida KT2440)
MLDLYLFQLLNGLGLGMIYFLIAVGLTIIFGLLNFVNFAHGAFFLLGAYLCYTAVAVTGN
FWLALLIAPLVVAALAWAVERLLIKRIYHLPHTFQILVTLGIALIIQEASVLIWGPVGKN
IAVPPELRGVLILGDFIYPYYRLFLIGFAALIGIGLWLLLERTRFGALVRAGSESTETVS
LLGTNIFRLFSLTFALGVGLAGVAGVLFAPLRGAQPFVGPEILGIAFVVVVIGGMGSFGG
ALVGGLLVGVVQSMMTSLWPQGASLMIYGAMAAVILVRPYGLFGRA