Protein Info for PP_0616 in Pseudomonas putida KT2440

Annotation: Branched-chain amino acid ABC transporter, ATP binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00005: ABC_tran" amino acids 23 to 178 (156 residues), 101.8 bits, see alignment E=1e-32 PF12399: BCA_ABC_TP_C" amino acids 225 to 250 (26 residues), 41.2 bits, see alignment (E = 2e-14)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 99% identity to ppg:PputGB1_0662)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q79 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PP_0616 Branched-chain amino acid ABC transporter, ATP binding protein (Pseudomonas putida KT2440)
MSDYLLETRHLELAYGPFKAVAGVDLKVRAGTIHTIIGPNGAGKTSLFHCLTGERQATAG
KILFNGQDIIRKPSHGRVALGMARSFQLTSLFQNLSVRENLRLAAQGRDGLGALNFWRSV
EHKRSHWNTADQVLERLKLSARAETLAGELSHGQQRVLEVGMSICAKPTLLMLDEPTSGM
GIDDIPVMTDLISDLGRDHTVLLIEHNMSIVMSISQRITVMSHGQILVEGTPEQVRNDER
VRTAYLGEAA