Protein Info for PP_0608 in Pseudomonas putida KT2440

Annotation: putative type 4 fimbrial biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 72 to 94 (23 residues), see Phobius details PF07963: N_methyl" amino acids 66 to 89 (24 residues), 24.5 bits, see alignment 7.7e-10 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 67 to 89 (23 residues), 19.8 bits, see alignment 2.6e-08

Best Hits

Predicted SEED Role

"FIG00954859: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q87 at UniProt or InterPro

Protein Sequence (122 amino acids)

>PP_0608 putative type 4 fimbrial biogenesis protein (Pseudomonas putida KT2440)
MPSWVSKTATAKADNICISVTPRCFTVHSSLDVLGYSFLAVGQEVQSPKLKAMTGKVAGG
AGMHARQGGMTLLEVLLAVVVVAVGMFAAAGLQLQALQAVDSARRNGQAAMAAHSEHERG
RR