Protein Info for PP_0595 in Pseudomonas putida KT2440

Annotation: Transcriptional regulator, LysR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 PF00126: HTH_1" amino acids 16 to 75 (60 residues), 56 bits, see alignment E=3.1e-19 PF03466: LysR_substrate" amino acids 100 to 303 (204 residues), 91.9 bits, see alignment E=3.8e-30

Best Hits

Swiss-Prot: 64% identical to BAUR_PSEAE: HTH-type transcriptional activator BauR (bauR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0595)

Predicted SEED Role

"LysR family transcriptional regulator PA0133" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88Q99 at UniProt or InterPro

Protein Sequence (305 amino acids)

>PP_0595 Transcriptional regulator, LysR family (Pseudomonas putida KT2440)
MSRRPDPLAQVSDFDIRLLKIYRSVVECGGFSAAENVLGIGRSAISQQMNDLEQRLGLRL
CQRGRAGFSLTEEGREVYHSALQLLSALETFRTEVNGLHQHLRGELNIGLTDNLVTLPHM
RITHALAELKDRGPDVRIQIRMIAPSQVEHGVLDGSLHVGVVPQTSPLSGLEYQPLYSER
SLLYCAVGHPLFYADDQQIDDERLNSQEAITPTFRLPADIQAHYQALNCTASASDREGMA
FLILTGRYIGYLPDHYAMFWVQQGRLRALKPKERFYDLSLSWVTRKGRRPNLVLESFLES
LAATR