Protein Info for PP_0593 in Pseudomonas putida KT2440

Annotation: putative ribosome-binding factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF01205: UPF0029" amino acids 16 to 116 (101 residues), 114 bits, see alignment E=3.5e-37 PF09186: DUF1949" amino acids 132 to 188 (57 residues), 42.6 bits, see alignment E=4.6e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppf:Pput_0633)

Predicted SEED Role

"FIG000605: protein co-occurring with transport systems (COG1739)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QA1 at UniProt or InterPro

Protein Sequence (194 amino acids)

>PP_0593 putative ribosome-binding factor (Pseudomonas putida KT2440)
MPSTLLDLCEYREEIRKSRFITLAGPISSAAEAMSFIERHSDLAATHNCWAWKLGAQYRS
SDDGEPGGTAGRPILAAIEAQDCDQVVVLVIRWYGGIQLGTGGLARAYGGGANKCLQQAP
KRLLVQRSHFSCSCSFSELALVKLRLAEVDGLVLDEQFTANGVDLVIALGDAHLAPLQQQ
LADLSRGRILLEAR