Protein Info for PP_0575 in Pseudomonas putida KT2440

Annotation: conserved membrane protein of unknown function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 139 to 155 (17 residues), see Phobius details PF01478: Peptidase_A24" amino acids 4 to 109 (106 residues), 59.7 bits, see alignment E=1.7e-20

Best Hits

KEGG orthology group: K02278, prepilin peptidase CpaA [EC: 3.4.23.43] (inferred from 100% identity to ppf:Pput_0614)

Predicted SEED Role

"Flp pilus assembly protein CpaA"

Isozymes

Compare fitness of predicted isozymes for: 3.4.23.43

Use Curated BLAST to search for 3.4.23.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QB9 at UniProt or InterPro

Protein Sequence (156 amino acids)

>PP_0575 conserved membrane protein of unknown function (Pseudomonas putida KT2440)
MQSIVLLLWLALCSEQDVRQRQISNVLTLGAAGCALAWLFSTGHSWIGAEASEAGWALAI
VMLLTLPGYMLGRFGADDVKLMGALALATSPQYVLGTFIGAGVTVLVWLLTRRRLWTLLN
PKVKKRLQALTEEMGDKQAFVPYVLSGFLLTAVWIQ