Protein Info for PP_0563 in Pseudomonas putida KT2440

Annotation: Response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 57 to 75 (19 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details PF00072: Response_reg" amino acids 45 to 150 (106 residues), 30.9 bits, see alignment E=2.7e-11 amino acids 164 to 275 (112 residues), 74.4 bits, see alignment E=8.4e-25 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 286 to 447 (162 residues), 152.3 bits, see alignment E=5.2e-49 PF00990: GGDEF" amino acids 291 to 444 (154 residues), 143 bits, see alignment E=7.2e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to ppu:PP_0563)

Predicted SEED Role

"Probable two-component response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q88QD1 at UniProt or InterPro

Protein Sequence (451 amino acids)

>PP_0563 Response regulator (Pseudomonas putida KT2440)
MSQAVEPSPQCPVQQLTRNGLRKDDPLDQLLLPVRKPVYILLQDHERAQRLAQQLEFFGL
VVQALPSAAAFLASISEYPPSAIIMDVDFTGAGLGLLLAAQVQQGLARSIPLLFFSHHEA
DTPTRLAAVRAGGQDFLTGSLEASSLLEKVELLTNTAPHDPLRVLIIDDSRTQAMYTERV
LAGAGMLTRSLTDPIRTMAELADFQPDLIILDLYMPACTGPELAKVIRHSDRYVSVPIIY
LSAEDDLDKQLDAMSEGGDDFLTKPFRSRHLITTVRNRAARARHLKARMVRDSLTGLYNH
THILQLLEDCSFRARREQQPLSFAMLDIDHFKKINDRHGHPMGDRVIKSLALFLKQRLRK
TDFIGRYGGEEFAIVMPNTALDAAHKVLDEIRRRFAEILYPAQPRDLQCTFSAGVVQLDE
GLDALTMASAADEALYRAKHAGRNCVVRVEP